PDB entry 1rxd

View 1rxd on RCSB PDB site
Description: Crystal structure of human protein tyrosine phosphatase 4A1
Class: structural genomics, unknown function
Keywords: Structural Genomics, NYSGXRC, unknown function, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2003-12-18, released 2004-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-04-01, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase type IVA, member 1; Protein tyrosine phosphatase IVA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rxda_
  • Chain 'B':
    Compound: protein tyrosine phosphatase type IVA, member 1; Protein tyrosine phosphatase IVA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rxdb_
  • Chain 'C':
    Compound: protein tyrosine phosphatase type IVA, member 1; Protein tyrosine phosphatase IVA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rxdc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxdA (A:)
    armnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlveke
    gihvldwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalie
    ggmkyedavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxdA (A:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav
    qfirqkrrgafnskqllylekyrpkmrlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxdB (B:)
    armnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlveke
    gihvldwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalie
    ggmkyedavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxdB (B:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
    avqfirqkrrgafnskqllylekyrpkmrlrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rxdC (C:)
    armnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlveke
    gihvldwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalie
    ggmkyedavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxdC (C:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav
    qfirqkrrgafnskqllylekyrpkmrlrf