PDB entry 1rx5

View 1rx5 on RCSB PDB site
Description: dihydrofolate reductase (e.c.1.5.1.3) complexed with 5,10-dideazatetrahydrofolate
Class: oxidoreductase
Keywords: oxido-reductase, nadp, trimethoprim resistance, methotrexate resistance, one-carbon metabolism, oxidoreductase
Deposited on 1996-09-19, released 1997-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.08: d1rx5a_
  • Heterogens: DDF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rx5A (A:)
    misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr