PDB entry 1rx4

View 1rx4 on RCSB PDB site
Description: dihydrofolate reductase (e.c.1.5.1.3) complexed with 5,10-dideazatetrahydrofolate and 2'-monophosphoadenosine 5'-diphosphoribose
Deposited on 1996-09-19, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rx4__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rx4_ (-)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr