PDB entry 1rx1

View 1rx1 on RCSB PDB site
Description: dihydrofolate reductase (e.c.1.5.1.3) complexed with nicotinamide adenine dinucleotide phosphate (reduced form)
Deposited on 1996-09-19, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1rx1__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rx1_ (-)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr