PDB entry 1rx0

View 1rx0 on RCSB PDB site
Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.
Deposited on 2003-12-18, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rx0A (A:)
    mvqtghrsltscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaa
    qlgfggvyiqtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqr
    hkfcpplctmekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyv
    vmcrtggpgpkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
    gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
    atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
    avqqyvrdsrvhqilegsnevmrilisrsllqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rx0A (A:)
    tscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyi
    qtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplct
    mekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpg
    pkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigsegqgfliavr
    glnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladmatrlvaarl
    mvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdyavqqyvrds
    rvhqilegsnevmrilisrsllqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rx0B (B:)
    mvqtghrsltscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaa
    qlgfggvyiqtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqr
    hkfcpplctmekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyv
    vmcrtggpgpkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
    gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
    atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
    avqqyvrdsrvhqilegsnevmrilisrsllqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rx0B (B:)
    tscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyi
    qtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplct
    mekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpg
    pkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigsegqgfliavr
    glnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladmatrlvaarl
    mvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdyavqqyvrds
    rvhqilegsnevmrilisrsllqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rx0C (C:)
    mvqtghrsltscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaa
    qlgfggvyiqtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqr
    hkfcpplctmekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyv
    vmcrtggpgpkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
    gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
    atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
    avqqyvrdsrvhqilegsnevmrilisrsllqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rx0C (C:)
    scidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyiq
    tdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplctm
    ekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpgp
    kgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigsegqgfliavrg
    lnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladmatrlvaarlm
    vrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdyavqqyvrdsr
    vhqilegsnevmrilisrsllqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rx0D (D:)
    mvqtghrsltscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaa
    qlgfggvyiqtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqr
    hkfcpplctmekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyv
    vmcrtggpgpkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
    gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
    atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
    avqqyvrdsrvhqilegsnevmrilisrsllqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rx0D (D:)
    tscidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyi
    qtdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplct
    mekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpg
    pkgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigsegqgfliavr
    glnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladmatrlvaarl
    mvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdyavqqyvrds
    rvhqilegsnevmrilisrsllqe