PDB entry 1rwz

View 1rwz on RCSB PDB site
Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) from A. fulgidus
Class: replication
Keywords: sliding clamp, torus, processivity factor, REPLICATION
Deposited on 2003-12-17, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase sliding clamp
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: PCN, AF0335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwza1, d1rwza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwzA (A:)
    midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
    ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
    ripelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmtete
    liefnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilap
    riese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwzA (A:)
    midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
    ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
    ripelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmtete
    liefnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilap
    ries