PDB entry 1rwx

View 1rwx on RCSB PDB site
Description: Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid
Deposited on 2003-12-17, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rwx.1
  • Chain 'B':
    Domains in SCOP 1.71: d1rwx.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rwxA (A:)
npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rwxB (B:)
aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
feqpdgraqmpttervtltrcfylfpgh