PDB entry 1rwx

View 1rwx on RCSB PDB site
Description: Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid
Class: hydrolase
Keywords: protein-small molecule inhibitor complex, HYDROLASE
Deposited on 2003-12-17, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwx.1
  • Chain 'B':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwx.1
  • Heterogens: YBH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwxA (A:)
    npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
    tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
    regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwxB (B:)
    aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
    feqpdgraqmpttervtltrcfylfpgh