PDB entry 1rwu

View 1rwu on RCSB PDB site
Description: Solution structure of conserved protein YbeD from E. coli
Class: structural genomics, unknown function
Keywords: mixed alpha-beta fold, Structural Genomics, Protein Structure Initiative, PSI, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-12-17, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0250 protein ybeD
    Species: Escherichia coli [TaxId:562]
    Gene: YBED, B0631, C0721, Z0776, ECS0669, SF0650, S0672
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwuA (A:)
    mgtshhhhhhssgrenlyfqghmktklnellefptpftykvmgqalpelvdqvvevvqrh
    apgdytptvkpsskgnyhsvsitinathieqvetlyeelgkidivrmvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwuA (A:)
    mktklnellefptpftykvmgqalpelvdqvvevvqrhapgdytptvkpsskgnyhsvsi
    tinathieqvetlyeelgkidivrmvl