PDB entry 1rws

View 1rws on RCSB PDB site
Description: Backbone Solution Structure of mixed alpha/beta protein PF1061
Class: unknown function
Keywords: residual dipolar couplings, structural genomics, UNKNOWN FUNCTION
Deposited on 2003-12-17, released 2003-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF1061
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rwsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwsA (A:)
    ahhhhhhgskmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvledd
    evkdgdfvevipvvsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwsA (A:)
    kmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfve
    vipvvsgg