PDB entry 1rwr

View 1rwr on RCSB PDB site
Description: Crystal structure of filamentous hemagglutinin secretion domain
Class: cell adhesion
Keywords: Type V secretion, beta-helix, adhesins, filamentous hemagglutinin, TPS domain, CELL ADHESION
Deposited on 2003-12-17, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.146
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamentous hemagglutinin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwrA (A:)
    qglvpqgqtqvlqggnkvpvvniadpnsggvshnkfqqfnvanpgvvfnngltdgvsrig
    galtknpnltrqasailaevtdtspsrlagtlevygkgadliianpngisvnglstlnas
    nltlttgrpsvnggrigldvqqgtvtierggvnatglgyfdvvarlvklqgavsskqgkp
    ladiavvaganrydhatrratpiaagargaaagayaidgtaagamygkhitlvssdsglg
    vrqlgslsspsaitvssqgeialgdatvqrgplslkgagvvsagklasgggavnvaggga
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwrA (A:)
    qglvpqgqtqvlqggnkvpvvniadpnsggvshnkfqqfnvanpgvvfnngltdgvsrig
    galtknpnltrqasailaevtdtspsrlagtlevygkgadliianpngisvnglstlnas
    nltlttgrpsvnggrigldvqqgtvtierggvnatglgyfdvvarlvklqgavsskqgkp
    ladiavvaganrydhatrratpiaagargaaagayaidgtaagamygkhitlvssdsglg
    vrqlgslsspsaitvssqgeialgdatvqrgplslkgagvvsagklasgggavnvag