PDB entry 1rwp

View 1rwp on RCSB PDB site
Description: Crystal structure of human caspase-1 in complex with 3-{6-[(8-hydroxy-quinoline-2-carbonyl)-amino]-2-thiophen-2-yl-hexanoylamino}-4-oxo-butyric acid
Class: hydrolase
Keywords: protein-small molecule inhibitor complex, HYDROLASE
Deposited on 2003-12-16, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwp.1
  • Chain 'B':
    Compound: Interleukin-1 beta convertase
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rwp.1
  • Heterogens: HQC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwpA (A:)
    npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
    tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
    regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwpA (A:)
    tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
    ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
    gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwpB (B:)
    aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
    feqpdgraqmpttervtltrcfylfpgh