PDB entry 1rwj

View 1rwj on RCSB PDB site
Description: c7-type three-heme cytochrome domain
Class: electron transport
Keywords: multiheme cytochrome c, cytochrome c7, Geobacter sulfurreducens, Geobacter metallireducens, heme coordination in c-type cytochromes, ELECTRON TRANSPORT
Deposited on 2003-12-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: ORF03300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rwja_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwjA (A:)
    kgmtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgksc
    gachngkdafssasdcgkchpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwjA (A:)
    kgmtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgksc
    gachngkdafssasdcgkchp