PDB entry 1rwi

View 1rwi on RCSB PDB site
Description: Extracellular domain of Mycobacterium tuberculosis PknD
Class: transferase
Keywords: beta propeller, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2003-12-16, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pknD
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PKND, RV0931C, MT0958, MTCY08C9.08
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05871 (Start-261)
      • cloning artifact (262-263)
      • expression tag (264-269)
    Domains in SCOPe 2.07: d1rwia1, d1rwia2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase pknD
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PKND, RV0931C, MT0958, MTCY08C9.08
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05871 (Start-261)
      • cloning artifact (262-263)
      • expression tag (264-269)
    Domains in SCOPe 2.07: d1rwib1, d1rwib2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwiA (A:)
    rpswsptqasgqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttv
    lpfnglyqpqglavdgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqga
    vyvadrgnnrvvklaagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaes
    nnqvvlpftditapwgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplava
    vdsdrtvyvadrgndrvvkltslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwiA (A:)
    gqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklagttvlpfnglyqpqglav
    dgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnrvvkl
    aagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftditap
    wgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyvadrgn
    drvvkltslehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rwiB (B:)
    rpswsptqasgqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttv
    lpfnglyqpqglavdgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqga
    vyvadrgnnrvvklaagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaes
    nnqvvlpftditapwgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplava
    vdsdrtvyvadrgndrvvkltslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwiB (B:)
    qtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklattvlpfnglyqpqglavdg
    agtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnrvvklaa
    gsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftditapwg
    iavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyvadrgndr
    vvkltslehhhhhh