PDB entry 1rwf

View 1rwf on RCSB PDB site
Description: Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide
Class: lyase
Keywords: chondroitinase, chondroitin, chondroitin lyase, lyase
Deposited on 2003-12-16, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.138
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitin AC lyase
    Species: ARTHROBACTER AURESCENS [TaxId:43663]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rwfa1, d1rwfa2, d1rwfa3
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwfA (A:)
    eaepgaaefaalrnrwvdqitgrnviqagdpdfakaitalnnkaadslakldaaagrtsv
    ftdlslakdaemvttytrlsqlatawatptaavfgdaavlaaikagladantlcyndrke
    evgnwwsweigvpraladamvllhaelsaaertaycaaidhfvpdpwlqfppkrgkitsv
    ganrvdlcqgiiirslagedptklnhavaglsqvwqyvtsgdgifrdgsfiqhsttpytg
    sygvvlltglsklfsllggtafevsdptrsiffdavegsfapvmingamadavrgrsisr
    eantgydlgasaieailllaramdpataarwrglcagwiardtyrpilnsasvprtalvk
    qleatgvapvaeatghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtg
    sgmtyfytsdlgqyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatal
    gevaavgqhlvgpgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsn
    tlttaagtiagtagtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvnings
    atvqqrnfatlyvnhgvgpvagsyaymvapgasvdltrkllegnkysvirndataqsvef
    ktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavseptqkaagltltlpegtws
    svlegagtlgtdadgrstltldttglsgktkliklkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwfA (A:)
    pgaaefaalrnrwvdqitgrnviqagdpdfakaitalnnkaadslakldaaagrtsvftd
    lslakdaemvttytrlsqlatawatptaavfgdaavlaaikagladantlcyndrkeevg
    nwwsweigvpraladamvllhaelsaaertaycaaidhfvpdpwlqfppkrgkitsvgan
    rvdlcqgiiirslagedptklnhavaglsqvwqyvtsgdgifrdgsfiqhsttpytgsyg
    vvlltglsklfsllggtafevsdptrsiffdavegsfapvmingamadavrgrsisrean
    tgydlgasaieailllaramdpataarwrglcagwiardtyrpilnsasvprtalvkqle
    atgvapvaeatghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgm
    tyfytsdlgqyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgev
    aavgqhlvgpgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlt
    taagtiagtagtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatv
    qqrnfatlyvnhgvgpvagsyaymvapgasvdltrkllegnkysvirndataqsvefkta
    kttaatfwkpgmagdlgasgpacvvfsrhgnelslavseptqkaagltltlpegtwssvl
    egagtlgtdadgrstltldttglsgktkliklkr