PDB entry 1rwc

View 1rwc on RCSB PDB site
Description: Crystal structure of Arthrobacter aurescens chondroitin AC lyase
Class: lyase
Keywords: chondroitin lyase, chondroitinase, hyaluronan
Deposited on 2003-12-16, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitin AC lyase
    Species: Arthrobacter aurescens
    Domains in SCOP 1.75: d1rwca1, d1rwca2, d1rwca3
  • Heterogens: NA, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rwcA (A:)
    eaepgaaefaalrnrwvdqitgrnviqagdpdfakaitalnnkaadslakldaaagrtsv
    ftdlslakdaemvttytrlsqlatawatptaavfgdaavlaaikagladantlcyndrke
    evgnwwsweigvpraladamvllhaelsaaertaycaaidhfvpdpwlqfppkrgkitsv
    ganrvdlcqgiiirslagedptklnhavaglsqvwqyvtsgdgifrdgsfiqhsttpytg
    sygvvlltglsklfsllggtafevsdptrsiffdavegsfapvmingamadavrgrsisr
    eantgydlgasaieailllaramdpataarwrglcagwiardtyrpilnsasvprtalvk
    qleatgvapvaeatghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtg
    sgmtyfytsdlgqyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatal
    gevaavgqhlvgpgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsn
    tlttaagtiagtagtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvnings
    atvqqrnfatlyvnhgvgpvagsyaymvapgasvdltrkllegnkysvirndataqsvef
    ktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavseptqkaagltltlpegtws
    svlegagtlgtdadgrstltldttglsgktkliklkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rwcA (A:)
    pgaaefaalrnrwvdqitgrnviqagdpdfakaitalnnkaadslakldaaagrtsvftd
    lslakdaemvttytrlsqlatawatptaavfgdaavlaaikagladantlcyndrkeevg
    nwwsweigvpraladamvllhaelsaaertaycaaidhfvpdpwlqfppkrgkitsvgan
    rvdlcqgiiirslagedptklnhavaglsqvwqyvtsgdgifrdgsfiqhsttpytgsyg
    vvlltglsklfsllggtafevsdptrsiffdavegsfapvmingamadavrgrsisrean
    tgydlgasaieailllaramdpataarwrglcagwiardtyrpilnsasvprtalvkqle
    atgvapvaeatghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgm
    tyfytsdlgqyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgev
    aavgqhlvgpgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlt
    taagtiagtagtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatv
    qqrnfatlyvnhgvgpvagsyaymvapgasvdltrkllegnkysvirndataqsvefkta
    kttaatfwkpgmagdlgasgpacvvfsrhgnelslavseptqkaagltltlpegtwssvl
    egagtlgtdadgrstltldttglsgktkliklkr