PDB entry 1rwb

View 1rwb on RCSB PDB site
Description: Cooperative Effect of Two Surface Amino Acid Mutations (Q252L and E170K) of Glucose Dehydrogenase from Bacillus megaterium IWG3 for the stabilization of Oligomeric State
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-12-16, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (169)
      • engineered (251)
    Domains in SCOPe 2.07: d1rwba_
  • Chain 'B':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (169)
      • engineered (251)
    Domains in SCOPe 2.07: d1rwbb_
  • Chain 'E':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (169)
      • engineered (251)
    Domains in SCOPe 2.07: d1rwbe_
  • Chain 'F':
    Compound: glucose 1-dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40288 (0-260)
      • engineered (169)
      • engineered (251)
    Domains in SCOPe 2.07: d1rwbf_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwbA (A:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtktlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwbB (B:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtktlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwbE (E:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtktlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rwbF (F:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtktlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtlypsfqagrg