PDB entry 1rw5

View 1rw5 on RCSB PDB site
Description: Solution structure of human prolactin
Class: hormone/growth factor
Keywords: Four helix bundle, cytokine
Deposited on 2003-12-16, released 2005-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rw5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rw5A (A:)
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc