PDB entry 1rw4

View 1rw4 on RCSB PDB site
Description: Nitrogenase Fe protein l127 deletion variant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-12-15, released 2004-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase iron protein 1
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: nifH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rw4a_
  • Heterogens: SF4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rw4A (A:)
    mamrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntime
    maaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddl
    dfvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rw4A (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
    licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
    alarkvvdnkllvipnpitmdeleellmefg