PDB entry 1rw3

View 1rw3 on RCSB PDB site
Description: The crystal structure of the monomeric reverse transcriptase from Moloney murine leukemia virus
Deposited on 2003-12-15, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.282
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rw3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rw3A (A:)
    gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
    rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
    ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
    dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
    qicqkqvkylgyllkegqrwltearketvmgqptpktprqlreflgtagfcrlwipgfae
    maaplypltktgtlfnwgpdqqkayqeikqalltapalglpdltkpfelfvdekqgyakg
    vltqklgpwrrpvaylskkldpvaagwppclrmvaaiavltkdagkltmgqplvikapha
    vealvkqppdrwlsnarmthyqallldtdrvqfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rw3A (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqrwltearketvmgqptpktprqlreflgtagfcrlwipgfaemaap
    lypnwgpdqqkayqeikqalltapalglpdltkpfelfvdekqgyakgvltqklgpwrrp
    vaylskkldpvaagwppclrmvaaiavltkdagkltmgqplvikaphavealvkqppdrw
    lsnarmthyqallldtdrvqfgp