PDB entry 1rw2

View 1rw2 on RCSB PDB site
Description: Three-dimensional structure of Ku80 CTD
Deposited on 2003-12-15, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rw2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rw2A (A:)
    mhhhhhhklkteqggahfsvsslaegsvtsvgsvnpaenfrvlvkqkkasfeeasnqlin
    hieqfldtnetpyfmksidcirafreeaikfseeqrfnnflkalqekveikqlnhfweiv
    vqdgitlitkeeasgssvtaeeakkflapkdk