PDB entry 1rw2

View 1rw2 on RCSB PDB site
Description: Three-dimensional structure of Ku80 CTD
Class: DNA binding protein
Keywords: Ku80, NHEJ, NMR, structure, DNA-PK, DNA BINDING PROTEIN
Deposited on 2003-12-15, released 2003-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase II, 80 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ku80 (566-710)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13010 (7-151)
      • cloning artifact (0)
      • expression tag (1-6)
    Domains in SCOPe 2.06: d1rw2a1, d1rw2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rw2A (A:)
    mhhhhhhklkteqggahfsvsslaegsvtsvgsvnpaenfrvlvkqkkasfeeasnqlin
    hieqfldtnetpyfmksidcirafreeaikfseeqrfnnflkalqekveikqlnhfweiv
    vqdgitlitkeeasgssvtaeeakkflapkdk