PDB entry 1rvz

View 1rvz on RCSB PDB site
Description: 1934 H1 Hemagglutinin in complex with LSTC
Class: Viral Protein
Keywords: Hemagglutinin, Influenza A Virus, Viral Protein
Deposited on 2003-12-15, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvza_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvze_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rvzl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvzA (A:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rvzC (C:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rvzE (E:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rvzG (G:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzG (G:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzH (H:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rvzI (I:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzI (I:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzJ (J:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rvzK (K:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvzK (K:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvzL (L:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp