PDB entry 1rvx

View 1rvx on RCSB PDB site
Description: 1934 H1 Hemagglutinin in complex with LSTA
Class: Viral Protein
Keywords: Hemagglutinin, Influenza A Virus, Viral Protein
Deposited on 2003-12-15, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rvxl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvxA (A:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvxB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rvxC (C:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvxD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rvxE (E:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rvxF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rvxG (G:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxG (G:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvxH (H:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rvxI (I:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxI (I:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvxJ (J:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rvxK (K:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxK (K:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rvxL (L:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvxL (L:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydy