PDB entry 1rvt

View 1rvt on RCSB PDB site
Description: 1930 H1 Hemagglutinin in complex with LSTC
Class: Viral Protein
Keywords: Hemagglutinin, Influenza A virus, Viral Protein
Deposited on 2003-12-15, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (Start-327)
    Domains in SCOPe 2.07: d1rvth_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (0-159)
    Domains in SCOPe 2.07: d1rvti_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (Start-327)
    Domains in SCOPe 2.07: d1rvtj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (0-159)
    Domains in SCOPe 2.07: d1rvtk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (Start-327)
    Domains in SCOPe 2.07: d1rvtl_
  • Chain 'M':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RVT (0-159)
    Domains in SCOPe 2.07: d1rvtm_
  • Heterogens: SIA, GAL, NDG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rvtH (H:)
    atnadtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvtH (H:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvtI (I:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rvtJ (J:)
    atnadtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvtJ (J:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvtK (K:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rvtL (L:)
    atnadtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvtL (L:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvtM (M:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp