PDB entry 1rvk

View 1rvk on RCSB PDB site
Description: crystal structure of enolase agr_l_2751 from agrobacterium tumefaciens
Deposited on 2003-12-14, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvkA (A:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvkA (A:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrv