PDB entry 1rvk

View 1rvk on RCSB PDB site
Description: Crystal structure of enolase AGR_L_2751 from Agrobacterium Tumefaciens
Class: structural genomics, unknown function
Keywords: Enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, unknown function
Deposited on 2003-12-14, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UAC1 (0-End)
      • modified residue (0)
      • modified residue (36)
      • modified residue (137)
      • modified residue (173)
      • modified residue (184)
      • modified residue (203)
      • modified residue (234)
      • modified residue (295)
      • modified residue (303)
      • modified residue (313)
      • modified residue (352)
    Domains in SCOPe 2.07: d1rvka1, d1rvka2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvkA (A:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvkA (A:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrv