PDB entry 1rvg

View 1rvg on RCSB PDB site
Description: crystal structure of class II fructose-bisphosphate aldolase from Thermus aquaticus in complex with Y
Class: lyase
Keywords: class II aldolase, metal-depdendent aldolase, lyase
Deposited on 2003-12-13, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-02, with a file datestamp of 2020-08-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rvga_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rvgb_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rvgc_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rvgd_
  • Heterogens: SO4, CO, NA, YT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvgA (A:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvgA (A:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieekdalltnpeearifmertgadylavaigtshgaykgkgr
    pfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedikkaislg
    iakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfgsvgra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvgB (B:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvgC (C:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvgD (D:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra