PDB entry 1rvf

View 1rvf on RCSB PDB site
Description: fab complexed with intact human rhinovirus
Class: Virus/Immune system
Keywords: POLYPROTEIN, COAT PROTEIN, CORE PROTEIN, RNA-DIRECTED RNA POLYMERASE, HYDROLASE, THIOL PROTEASE, MYRISTYLATION, COMPLEX (COAT PROTEIN/IMMUNOGLOBULIN), Icosahedral virus
Deposited on 1996-09-05, released 1998-02-25
The last revision prior to the SCOP 1.75 freeze date was dated 1998-02-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.212
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: human rhinovirus 14 coat protein
    Species: Human rhinovirus 14
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rvf1_
  • Chain '2':
    Compound: human rhinovirus 14 coat protein
    Species: Human rhinovirus 14
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03303 (Start-261)
      • conflict (169)
    Domains in SCOP 1.75: d1rvf.1
  • Chain '3':
    Compound: human rhinovirus 14 coat protein
    Species: Human rhinovirus 14
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rvf3_
  • Chain '4':
    Compound: human rhinovirus 14 coat protein
    Species: Human rhinovirus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rvf.1
  • Chain 'H':
    Compound: fab 17-ia
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (0-118)
      • conflict (1)
      • conflict (8)
      • conflict (15)
      • conflict (27)
      • conflict (29-34)
      • conflict (42)
      • conflict (49)
      • conflict (54)
      • conflict (56-57)
      • conflict (61)
      • conflict (71)
      • conflict (73)
      • conflict (76)
      • conflict (82)
      • conflict (98)
      • insertion (100-101)
      • conflict (102)
    Domains in SCOP 1.75: d1rvfh_
  • Chain 'L':
    Compound: fab 17-ia
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA56279 (0-109)
      • conflict (13-14)
      • conflict (17)
      • conflict (20)
      • conflict (23)
      • conflict (25)
      • conflict (29)
      • conflict (31)
      • conflict (34)
      • conflict (40)
      • conflict (49)
      • conflict (75)
      • conflict (87)
      • conflict (89-92)
      • conflict (94)
      • conflict (98)
    Domains in SCOP 1.75: d1rvfl_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1rvf1 (1:)
    glgdeleevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhf
    ngsetdvecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelft
    yvrfdseytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkv
    gdtsrfsvpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvk
    irvyhrakhveawiprapralpytsigrtnypkntepvikkrkgdiksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf1 (1:)
    tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
    vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
    pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
    yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
    apralpytsigrtnypkntepvikkrkgdiksy
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1rvf2 (2:)
    spnveacgysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsv
    crfytldsktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsg
    cllvvvipehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgn
    llifphqfinlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpi
    tvtiapmctefsgirsksivpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf2 (2:)
    gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
    sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
    pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
    finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
    ctefsgirsksivpq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvf3 (3:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1rvf4 (4:)
    gaqvstqksgshenqniltngsnqtftvinyykdaastssagqslsmdpskftepvkdlm
    lkgapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf4 (4:)
    inyykdaastssagqslsmdpskftepvkdlmlkgapaln
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvfH (H:)
    qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
    ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvfL (L:)
    qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikrada