PDB entry 1rvf

View 1rvf on RCSB PDB site
Description:
Deposited on 1996-09-05, released 1998-02-25
The last revision prior to the SCOP 1.65 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.212
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvf1_
  • Chain '2':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvf.1
  • Chain '3':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvf3_
  • Chain '4':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvf.1
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvfh_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rvfl_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1rvf1 (1:)
    glgdeleevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhf
    ngsetdvecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelft
    yvrfdseytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkv
    gdtsrfsvpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvk
    irvyhrakhveawiprapralpytsigrtnypkntepvikkrkgdiksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf1 (1:)
    tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
    vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
    pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
    yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
    apralpytsigrtnypkntepvikkrkgdiksy
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1rvf2 (2:)
    spnveacgysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsv
    crfytldsktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsg
    cllvvvipehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgn
    llifphqfinlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpi
    tvtiapmctefsgirsksivpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf2 (2:)
    gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
    sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
    pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
    finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
    ctefsgirsksivpq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvf3 (3:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1rvf4 (4:)
    gaqvstqksgshenqniltngsnqtftvinyykdaastssagqslsmdpskftepvkdlm
    lkgapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvf4 (4:)
    inyykdaastssagqslsmdpskftepvkdlmlkgapaln
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvfH (H:)
    qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
    ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rvfL (L:)
    qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikrada