PDB entry 1rvd

View 1rvd on RCSB PDB site
Description: h-ras complexed with diaminobenzophenone-beta,gamma-imido-GTP
Class: hydrolase
Keywords: GTP hydrolase, signal transduction, cancer, g-domain
Deposited on 1999-05-03, released 1999-05-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • mutation (11)
    Domains in SCOPe 2.01: d1rvda_
  • Heterogens: MG, DBG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rvdA (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rvdA (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagqeeysa
    mrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartve
    srqaqdlarsygipyietsaktrqgvedafytlvreirqh