PDB entry 1rv8

View 1rv8 on RCSB PDB site
Description: Class II fructose-1,6-bisphosphate aldolase from Thermus aquaticus in complex with cobalt
Class: lyase
Keywords: class II aldolase, metal-depdendent aldolase, LYASE
Deposited on 2003-12-12, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rv8a_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rv8b_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rv8c_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphate aldolase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rv8d_
  • Heterogens: SO4, CO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rv8A (A:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv8A (A:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagikdalltnpeearifmertgadylavaigtshgaykgkgrpf
    idharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedikkaislgia
    kintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfgsvgra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv8B (B:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv8C (C:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv8D (D:)
    mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
    tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
    aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
    ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
    kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
    svgra