PDB entry 1rv7

View 1rv7 on RCSB PDB site
Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl protease, multi-drug resistance, Lopinavir
Deposited on 2003-12-12, released 2004-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QM22 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.04: d1rv7a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QM22 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.04: d1rv7b_
• Heterogens: AB1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rv7A (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rv7B (B:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf