PDB entry 1rv6

View 1rv6 on RCSB PDB site
Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
Class: hormone/growth factor/receptor
Keywords: PlGF, VEGF family, cystine knot, growth factor, ligand-receptor complex, specificity, HORMONE-GROWTH FACTOR-RECEPTOR COMPLEX
Deposited on 2003-12-12, released 2004-01-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Compound: placenta growth factor (PlGF)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rv6v_
  • Chain 'W':
    Compound: placenta growth factor (PlGF)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rv6w_
  • Chain 'X':
    Compound: FLT1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rv6x_
  • Chain 'Y':
    Compound: FLT1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rv6y_
  • Heterogens: B3P, HOH

PDB Chain Sequences:

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1rv6V (V:)
    evevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvp
    vetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6V (V:)
    vvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpvet
    anvtmqllkirsgdrpsyveltfsqhvrcecrpl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1rv6W (W:)
    evevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvp
    vetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6W (W:)
    evvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpve
    tanvtmqllkirsgdrpsyveltfsqhvrcecrpl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1rv6X (X:)
    dtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsr
    kgfiisnatykeiglltceatvnghlyktnylthrqtnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6X (X:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1rv6Y (Y:)
    dtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsr
    kgfiisnatykeiglltceatvnghlyktnylthrqtnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6Y (Y:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthr