PDB entry 1rv6

View 1rv6 on RCSB PDB site
Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
Deposited on 2003-12-12, released 2004-01-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Domains in SCOP 1.71: d1rv6v_
  • Chain 'W':
    Domains in SCOP 1.71: d1rv6w_
  • Chain 'X':
    Domains in SCOP 1.71: d1rv6x_
  • Chain 'Y':
    Domains in SCOP 1.71: d1rv6y_

PDB Chain Sequences:

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1rv6V (V:)
    evevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvp
    vetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6V (V:)
    vvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpvet
    anvtmqllkirsgdrpsyveltfsqhvrcecrpl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1rv6W (W:)
    evevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvp
    vetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6W (W:)
    evvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpve
    tanvtmqllkirsgdrpsyveltfsqhvrcecrpl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1rv6X (X:)
    dtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsr
    kgfiisnatykeiglltceatvnghlyktnylthrqtnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6X (X:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1rv6Y (Y:)
    dtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsr
    kgfiisnatykeiglltceatvnghlyktnylthrqtnti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv6Y (Y:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthr