PDB entry 1rv4

View 1rv4 on RCSB PDB site
Description: e75l mutant of rabbit cytosolic serine hydroxymethyltransferase
Class: transferase
Keywords: one carbon metabolism, transferase
Deposited on 2003-12-12, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.202
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, cytosolic
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: SHMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07511 (Start-482)
      • engineered (73)
    Domains in SCOPe 2.07: d1rv4a_
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase, cytosolic
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: SHMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07511 (Start-482)
      • engineered (73)
    Domains in SCOPe 2.07: d1rv4b_
  • Heterogens: PO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rv4A (A:)
    atavngaprdaalwssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasrav
    lealgsclnnkyslgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgs
    panfavytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyi
    dydrleenarlfhpkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvv
    pspfehchvvtttthktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglq
    ggphnhaiagvavalkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilv
    dlrskgtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkv
    ahfihrgieltvqiqddtgpratlkefkeklagdekhqravralrqevesfaalfplpgl
    pgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv4A (A:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrseilynleslinsavfpglqggphnhaiagvavalkqamt
    pefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvleacs
    iacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqddtgp
    ratlkefkeklagdekhqravralrqevesfaalfplpglpgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rv4B (B:)
    atavngaprdaalwssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasrav
    lealgsclnnkyslgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgs
    panfavytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyi
    dydrleenarlfhpkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvv
    pspfehchvvtttthktlrgcragmifyrrgvrsvdpktgkeilynleslinsavfpglq
    ggphnhaiagvavalkqamtpefkeyqrqvvancralsaalvelgykivtggsdnhlilv
    dlrskgtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkv
    ahfihrgieltvqiqddtgpratlkefkeklagdekhqravralrqevesfaalfplpgl
    pgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv4B (B:)
    wssheqmlaqplkdsdaevydiikkesnrqrvgleliasenfasravlealgsclnnkys
    lgypgqryyggtehideletlcqkralqaygldpqcwgvnvqpysgspanfavytalvep
    hgrimgldlpdgghlthgfmtdkkkisatsiffesmaykvnpdtgyidydrleenarlfh
    pkliiagtscysrnldygrlrkiadengaylmadmahisglvvagvvpspfehchvvttt
    thktlrgcragmifyrrgvrsvdkeilynleslinsavfpglqggphnhaiagvavalkq
    amtpefkeyqrqvvancralsaalvelgykivtggsdnhlilvdlrskgtdggraekvle
    acsiacnkntcpgdksalrpsglrlgtpaltsrgllekdfqkvahfihrgieltvqiqdd
    tgpratlkefkeklagdekhqravralrqevesfaalfplpglpgf