PDB entry 1rv1

View 1rv1 on RCSB PDB site
Description: crystal structure of human mdm2 with an imidazoline inhibitor
Class: ligase
Keywords: mdm2, p53, protein-protein interaction
Deposited on 2003-12-12, released 2004-01-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.256
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: HOMO SAPIENS
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOP 1.73: d1rv1a_
  • Chain 'B':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: HOMO SAPIENS
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOP 1.73: d1rv1b_
  • Chain 'C':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: HOMO SAPIENS
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOP 1.73: d1rv1c_
  • Heterogens: IMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1A (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1B (B:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1C (C:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv