PDB entry 1rv1

View 1rv1 on RCSB PDB site
Description: crystal structure of human mdm2 with an imidazoline inhibitor
Class: ligase
Keywords: mdm2, p53, protein-protein interaction, ligase
Deposited on 2003-12-12, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.266
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOPe 2.07: d1rv1a_
  • Chain 'B':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOPe 2.07: d1rv1b_
  • Chain 'C':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered (8)
    Domains in SCOPe 2.07: d1rv1c_
  • Heterogens: IMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1A (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1B (B:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv1C (C:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv