PDB entry 1rv0

View 1rv0 on RCSB PDB site
Description: 1930 Swine H1 Hemagglutinin complexed with LSTA
Class: Viral Protein
Keywords: Hemagglutinin, Influenza A Virus, Viral Protein
Deposited on 2003-12-12, released 2004-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0l_
  • Chain 'M':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rv0m_
  • Heterogens: NDG, DAN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rv0H (H:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv0H (H:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv0I (I:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rv0J (J:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv0J (J:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv0K (K:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rv0L (L:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rv0L (L:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv0M (M:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
    karsqlrnnakeigngcfefyhkcddacmesvrngtydyp