PDB entry 1ruz

View 1ruz on RCSB PDB site
Description: 1918 H1 Hemagglutinin
Class: Viral Protein
Keywords: Hemagglutinin, INFLUENZA A VIRUS, Viral Protein
Deposited on 2003-12-12, released 2004-03-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFZ1 (Start-327)
      • conflict (326-327)
    Domains in SCOPe 2.03: d1ruzh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ruzi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFZ1 (Start-327)
      • conflict (326-327)
    Domains in SCOPe 2.03: d1ruzj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ruzk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFZ1 (Start-327)
      • conflict (326-327)
    Domains in SCOPe 2.03: d1ruzl_
  • Chain 'M':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/South Carolina/1/18 (H1N1)) [TaxId:59375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ruzm_
  • Heterogens: NDG, NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ruzH (H:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruzH (H:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruzI (I:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ruzJ (J:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruzJ (J:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruzK (K:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydyp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ruzL (L:)
    atnadticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruzL (L:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruzM (M:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydyp