PDB entry 1ruy

View 1ruy on RCSB PDB site
Description: 1930 Swine H1 Hemagglutinin
Class: Viral Protein
Keywords: Hemagglutinin, INFLUENZA A VIRUS, Viral Protein
Deposited on 2003-12-12, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruyh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruyi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruyj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruyk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruyl_
  • Chain 'M':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/swine/Iowa/15/30(H1N1)) [TaxId:260809]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ruym_
  • Heterogens: NDG, NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ruyH (H:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruyH (H:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruyI (I:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ruyJ (J:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruyJ (J:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruyK (K:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ruyL (L:)
    adaddtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcn
    iagwllgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfei
    fpktsswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvl
    wgvhhpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvkstklrmatglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruyL (L:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
    llgnpecdllltvsswsyivetpnsdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhntnkgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
    hpptstdqqnlyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnlvapryafalnrgsgsgiiisnapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvkstklrmatglrnipar
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruyM (M:)
    glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp