PDB entry 1rux

View 1rux on RCSB PDB site
Description: maximum likelihood refinement of adenovirus type 5 hexon with tnt
Deposited on 1999-04-26, released 2000-03-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ruxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ruxA (A:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitkegiq
    igvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptneng
    gqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthisympt
    ikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrn
    telsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvintet
    ltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialylpdkl
    kyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglry
    rsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdg
    asikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnvpi
    sipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvaitf
    dssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyipe
    sykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqaypan
    fpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldmtf
    evdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ruxA (A:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa