PDB entry 1ruu

View 1ruu on RCSB PDB site
Description: Solution structure of porcine peptide YY (pPYY) bound to DPC micelles
Class: hormone/growth factor
Keywords: alpha-helical, micelle-bound form, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-12-12, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide YY
  Species: Sus scrofa [TaxId:9823]
  Gene: PYY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68005 (0-35)
  Domains in SCOPe 2.08: d1ruua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ruuA (A:)
  ypakpeapgedaspeelsryyaslrhylnlvtrqry