PDB entry 1rut

View 1rut on RCSB PDB site
Description: Complex of LMO4 LIM domains 1 and 2 with the ldb1 LID domain
Class: protein binding
Keywords: b-tandem zipper, LIM domain, fusion protein, PROTEIN BINDING
Deposited on 2003-12-11, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Fusion protein of Lmo4 protein and LIM domain-binding protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: lmo4, ldb1
    Database cross-references and differences (RAF-indexed):
    • GB AAH03488
      • engineered (36)
      • engineered (48)
      • linker (147)
    • Uniprot P70662 (148-End)
    Domains in SCOPe 2.07: d1rutx1, d1rutx2, d1rutx3, d1rutx4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >1rutX (X:)
gslswkrcagcggkiadrfllyamdsywhsrclkcsscqaqlgdigtssytksgmilcrn
dyirlfgnsgacsacgqsipaselvmraqgnvyhlkcftcstcrnrlvpgdrfhyingsl
fcehdrptalinghlnsggsggsggsggdvmvvgeptlmggefgdederlitrlentqfd
aangidde

    Sequence, based on observed residues (ATOM records): (download) 
    >1rutX (X:)
swkrcagcggkiadrfllyamdsywhsrclkcsscqaqlgdigtssytksgmilcrndyi
rlfgnsgacsacgqsipaselvmraqgnvyhlkcftcstcrnrlvpgdrfhyingslfce
hdrptaligdvmvvgeptlmggefgdederlitrlen