PDB entry 1rur

View 1rur on RCSB PDB site
Description: Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected at SSRL beamline 9-1.
Class: immune system
Keywords: immunoglobulin, catalytic antibody, water oxidation, amino acid modification
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin 13G5, heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rurh1, d1rurh2
  • Chain 'L':
    Compound: immunoglobulin 13G5, light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1rurl1, d1rurl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rurH (H:)
    evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
    nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rurL (L:)
    divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
    sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdtkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn