PDB entry 1ruq

View 1ruq on RCSB PDB site
Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.
Class: immune system
Keywords: immunoglobulin, catalytic antibody, water oxidation, amino acid modification, IMMUNE SYSTEM
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.219
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin 13G5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ruqh1, d1ruqh2
  • Chain 'L':
    Compound: immunoglobulin 13G5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ruql1, d1ruql2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruqH (H:)
    evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
    nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ruqL (L:)
    divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
    sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdtkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn