PDB entry 1rum

View 1rum on RCSB PDB site
Description: Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5 with a data set collected at SSRL beamline 9-1.
Class: immune system
Keywords: immunoglobulin, catalytic antibody, water oxidation, amino acid modification
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.175
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin igg2a, heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rumh1, d1rumh2
  • Chain 'L':
    Compound: immunoglobulin igg2a, light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d1ruml1, d1ruml2
  • Heterogens: BEZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rumH (H:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rumL (L:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec