PDB entry 1rua

View 1rua on RCSB PDB site
Description: Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6 with a data set collected at SSRL beamline 11-1.
Class: immune system
Keywords: immunoglobulin, catalytic antibody, water oxidation, amino acid modification, immune system
Deposited on 2003-12-11, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin igg2a, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ruah1, d1ruah2
  • Chain 'L':
    Compound: immunoglobulin igg2a, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rual1, d1rual2
  • Heterogens: ACT, GOL, BEZ, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ruaH (H:)
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ruaL (L:)
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrnec