PDB entry 1ru8

View 1ru8 on RCSB PDB site
Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23
Deposited on 2003-12-11, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ru8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ru8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ru8A (A:)
    mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqar
    algiplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevy
    tpawgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhv
    ageggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru8A (A:)
    gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
    iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
    rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
    efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ru8B (B:)
    mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqar
    algiplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevy
    tpawgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhv
    ageggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru8B (B:)
    gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
    iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
    rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
    efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh