PDB entry 1ru8

View 1ru8 on RCSB PDB site
Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23
Class: structural genomics, unknown function
Keywords: alpha beta globular protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-12-11, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative n-type ATP pyrophosphatase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2K6 (Start-228)
      • modified residue (36)
      • modified residue (45)
      • modified residue (131)
      • modified residue (142)
      • modified residue (193)
      • cloning artifact (229-231)
    Domains in SCOPe 2.07: d1ru8a1, d1ru8a2
  • Chain 'B':
    Compound: putative n-type ATP pyrophosphatase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2K6 (Start-228)
      • modified residue (36)
      • modified residue (45)
      • modified residue (131)
      • modified residue (142)
      • modified residue (193)
      • cloning artifact (229-231)
    Domains in SCOPe 2.07: d1ru8b1, d1ru8b2
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ru8A (A:)
    mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqar
    algiplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevy
    tpawgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhv
    ageggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru8A (A:)
    gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
    iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
    rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
    efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ru8B (B:)
    mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqar
    algiplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevy
    tpawgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhv
    ageggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru8B (B:)
    gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
    iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
    rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
    efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh